PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_52321.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 342aa    MW: 36315.4 Da    PI: 10.1425
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_52321.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP46.69.2e-1556864878
                  SEEETTT--SS--S-STTTT-------S--- CS
           SBP 48 rfhelsefDeekrsCrrrLakhnerrrkkqa 78
                  rfh l efDe krsCr+rL++hn+rrrk+q+
  MLOC_52321.4 56 RFHLLGEFDEVKRSCRKRLDGHNRRRRKPQP 86
                  9***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114111.341984IPR004333Transcription factor, SBP-box
PfamPF031103.3E-75583IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-115588IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.103.8E-45571IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
AGAADGAGVL RGGVHGRPVP VPRVPPPAQG LRGALQDARR RRRRPAAALL PAVQQRFHLL  60
GEFDEVKRSC RKRLDGHNRR RRKPQPDPLN PAGLFANHHG VPRFASYPQI FSPTSMAEPK  120
WPGGIAVKTE ADAFHEQYYS FNGAASLFHH GKPERKHFPF LTDGGDATFG CQPPAFTITP  180
SSESSSNSSR HSNGKTTMFA HDGGPDHNCA LSLLSDNPAP AHIMNPAEAH HLGGGGGVTI  240
QYGGGGGGKV ARLHNNGDVS LTGLSYVSLG DKGAPMLLHT SNRSQHAAAT ATTAVTTSTA  300
PAPTASQMQQ YHGYYHHQHQ VGADQGNHQD AGGMHALPFS SW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13843RRRRRR
26683KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3560770.0AK356077.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1029L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232756.14e-86PREDICTED: squamosa promoter-binding-like protein 2
SwissprotQ0JGI12e-69SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLM0WKB30.0M0WKB3_HORVD; Uncharacterized protein
STRINGMLOC_52321.20.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-15SBP family protein